SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g460740.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g460740.1
Domain Number 1 Region: 17-243
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.53e-80
Family Leucine aminopeptidase, C-terminal domain 0.00000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr2g460740.1
Sequence length 246
Comment | leucine aminopeptidase (cytosol aminopeptidase), putative | HC | chr2:25059081-25053655 | 20130731
Sequence
MCCIIQFSVHGLLILWITFASGGYNIKTGPGCMIELMKFDMGGSAAVFGAAKAIGQIKPL
GVEVHFIVAACENMISGTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYTCNQGVD
KIIDLATLTGACIIALGPSIAGAFTTSDDLAKEVFDASDVSGEKLWRMPMEESYWESMKS
GVADMLNTGGRQGGAITAALFLKQFVDEKVQWMHIDLAGPVWNEKQRCATGFGVSTLVEW
VLRNAS
Download sequence
Identical sequences A0A072VIT3
XP_013464035.1.50012 Medtr2g460740.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]