SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g460760.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g460760.1
Domain Number 1 Region: 84-265
Classification Level Classification E-value
Superfamily Macro domain-like 9.42e-26
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 264-357
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.22e-21
Family Leucine aminopeptidase, C-terminal domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr2g460760.1
Sequence length 358
Comment | cytosol aminopeptidase family protein | HC | chr2:25067596-25065494 | 20130731
Sequence
MSGAASSSTILTTSLVFSSSFSSSRLFIRRRLPLRSASSPLRRLCLTREVPVRNLIMPPR
ATLGFTHPANTETPKISFAAKDIDTDVAEWKGDLLAVAVTEKDVTRDGELKFQNSILRTL
DSKLGGLLGEASSEEDFTGKLGQSTLLRITPAAGLGSKRLALLGLGPSASSTAAFKTLGE
SVASAANFAQAAHVAVVVLPTSKGLSAPNIASAIATGTVVGTFEDNRFKSESKKKPVLKS
LDIIGLGTGPEFEKKLKYAGDVSSGIILGKELVNSPPNVLTPGVLAEEASKIASTYSDVF
TAKVLDAEQCKELKMGSYLAVAAASANPPQFIHLCYKPPTGPVNVKLALVGKGLTFDR
Download sequence
Identical sequences A0A072V8W3
XP_013464036.1.50012 Medtr2g460760.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]