SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr3g065110.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g065110.2
Domain Number 1 Region: 214-353,388-452
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.21e-18
Family Bacterial dinuclear zinc exopeptidases 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr3g065110.2
Sequence length 589
Comment | M28 Zn-peptidase nicastrin | HC | chr3:29362029-29369820 | 20130731
Sequence
MALTFIFLFFIPHLLSSISAQSTSMESVPDLQSTMYTDVDGFPCVRLLSLSGTIGCSNPG
RDKVVAPIVRFENVDDVTELSSILVSMDQFPTLFNRLSADPSFASKVGGVLVESVTDSQK
KLNGFSPDQKFPLAEFAPYHNISYEWNPIGSGIMWKSYGFPVFLLTESGTKTLQEFVLKG
EDKKKAYTSNVAEFDLVMQTMKSGTHDSESCLNEGTCLPLGGYSVWSALPPINNSSSKPS
KPIILTVASMDSASFFRDRSLGADSPISGLIALLAAADALSHLDGIGDLSKQLVFVVFTG
EAWGYLGSRRFLVELDEHSDAVQGLNHSLIEKVLEIGSVGKGLSQGAKNFFAHAERDSSA
TNQIMVALKHAQESLLSEDIRITSASASNPGIPPSSLMTFWNKNPGISGVVLEDFDSSFV
NEFYHSYLDDLSNVNSSAVVAAASLVARTLYILASETNDVQNSTLAAINVNVSLVEQLVG
CLLGCDPGLSCELVKKYISPASTCASNYVGVILDEPSSTPNPGYINDVPRFIWNFLADIT
SISKENSSSGCQQGCSGSDEVCIKAETDGKGVCVLSTTRIRHACYHLML
Download sequence
Identical sequences G7J8R2
XP_003600688.2.50012 Medtr3g065110.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]