SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr3g083250.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g083250.1
Domain Number 1 Region: 582-728
Classification Level Classification E-value
Superfamily BRCA2 helical domain 1.57e-40
Family BRCA2 helical domain 0.00058
Further Details:      
 
Domain Number 2 Region: 729-858
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.28e-37
Family Single strand DNA-binding domain, SSB 0.00015
Further Details:      
 
Domain Number 3 Region: 861-890,1008-1090
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.68e-22
Family Single strand DNA-binding domain, SSB 0.015
Further Details:      
 
Domain Number 4 Region: 891-1008
Classification Level Classification E-value
Superfamily BRCA2 tower domain 1.96e-18
Family BRCA2 tower domain 0.0035
Further Details:      
 
Domain Number 5 Region: 1099-1250
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000223
Family Single strand DNA-binding domain, SSB 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr3g083250.1
Sequence length 1254
Comment | breast cancer type 2 susceptibility protein | HC | chr3:37568957-37576662 | 20130731
Sequence
MSSWQILPDADNNYRWQINSDDTSNVIPPSPPPFSIPTPPLPSMYDLLIHASASHLFQPQ
EEENAIDDSFGFANSLFKTGSGRKVTISSKGLVRAKTLLGLGLHEETVGANIQTPQNAKK
FNSFHQDEPRLQVIDSCKKTSAASFQSPLVSRLKNGFENKIVQPDTGSRSGVGAKQAPIK
FQTGVSNIQAPQTQNASFFDAFDEELPDLQLMDSCKKMSAASFQSPLVGRLHMGSENKVA
QLDSGSVSGGKDAPLTNSLFKTGSGRKVTISSKGLVRAKTLLGLGLHEETVGANIQTPQN
AEKLHAFDEELPHVQLMDSCKMMSSASFQSPLVGRLKNGFESKFVQPDSGGGAKQAPIKF
QTASGRSLSISGDALKRARRLLGDPDLGDFFDGGDSLFSFLDQGQTSTITSSAERSESKN
THTPLVHQMTPENHPNHMSKSFTYPLQPSKQMEFSNKLRNEGNGNNLIVKFDDVVNESDC
GCKSSITPGQKPLYNKNEVADTTIKSSSLNGFSSRMDSREKPLGRALVDISNTIKTVHTN
HKQPASGKRRIGLHATVSSFKKPRISNISASGGQDVQYFSNDLAQLSSGASGFKRKVSTR
YPFHHPRMYIKDYFAVPPLEQKVVSVISNFPNPARQVTSCNAGAYIFHDGSDSNDMGAEA
FIHLLTQHGASLRFASKEWVLNHYKWIVWKLACYERCYPARCAGKFLTVSNVLEELKYRY
EREVNHGHRSTIKKILEGDGLPSSMMTLCISSIHSDHVLDSGALSEPQTGNQSNEALKVE
LTDGWYSINAILDVPLSKQLAAGRLFVGQKLRIWGAGLCGWNGPVSPLEVSSTVSLLLHI
NGTYRAHWADRLGLCKVAGPPLAFKCIKRNGGLVPQTLAGITRIYPILYKERLSSGRSVV
ISERMENKMMELHNQRRSAVVDNIVSEYQKEMTGSHIYDYGNSEGAKIYKMLETAAEPEF
LMADMTPEQLSSFAAYKAKLNANRQSQMESSIEKALKDSGLGDREVTPFMRLRVVGLTYK
NQRDKPTEGIVTIWNPTQKQRQELSEGEAYAIAELIPSGSDSDVLHLQTRGSTTKWLPLS
SNAKEQFKPFSNNRNSIPLSSLSDIPLSNEFDVVAFVVHVGKVYTSSQQKKQWVFVTDGS
IMNGLQSQKVTDTLLAICFCSPLFDHDSFPPINHNLAGSTVGFCNLIKKEKDHTNHIWVA
DANEISTYYLKFDSPQCSHLRNAASSVRRWASNSSLIIEKLKEKVLGIVGDCKA
Download sequence
Identical sequences G7J9J4
XP_003601582.2.50012 Medtr3g083250.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]