SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr3g088590.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g088590.1
Domain Number 1 Region: 90-278,383-474
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.71e-81
Family Bacterial dinuclear zinc exopeptidases 0.000000151
Further Details:      
 
Domain Number 2 Region: 262-381
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 4.93e-21
Family Bacterial exopeptidase dimerisation domain 0.0000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr3g088590.1
Sequence length 476
Comment | IAA-amino acid hydrolase ILR1-like protein | HC | chr3:40061281-40052951 | 20130731
Sequence
MKFRNSLFYFMIIFSSTVIILEHFAVSTAVKIPSAAYDRVLFSDRRCCDRENNELTLSPC
KNVTRKAKTATNCEVWNEACSEAVLSVARLPETVEWLKSVRRKIHENPELAFEEIETSRL
IRKELDLMEVSYRYPLAKTGIRAWIGTGGPPFVAVRADMDALPIQEGVEWEYKSKVAGKM
HACGHDAHVAMLIGAAKILKTREHLLKGTVILLFQPAEEAGNGAKRMIQDGALEDVEAIF
AVHVSHEHPTGMIGSRPGPLLAGCGFFRAVISGKRASAANPRNSADPVLAASAAVISIQG
IVSRESNPLDSQVVSVTSFNGGNSHDMIPDSVVIGGTFRAFSNTSFYQLLERIEQVIVQQ
ASVYSCFAEVDFFEKEYTIYPPTVNDDQMYEHVKKVSIDLLGQKNFRVVPPMMGAEDYSF
YSQVIPSAFFYIGIRNETLGSTHTGHSPHFTIDEDALPIGAAVHATIAERYLNEHG
Download sequence
Identical sequences Q0GXX3
XP_003602066.1.50012 Medtr3g088590.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]