SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr3g088860.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g088860.1
Domain Number 1 Region: 7-92,247-469
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.73e-109
Family Bacterial dinuclear zinc exopeptidases 0.00047
Further Details:      
 
Domain Number 2 Region: 93-246
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 5.13e-37
Family Aminopeptidase/glucanase lid domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr3g088860.1
Sequence length 482
Comment | aspartyl aminopeptidase-like protein, putative | HC | chr3:34033214-34039423 | 20130731
Sequence
makeesthtvvsdlinflnasptafhavddakkrlqsagyhqiseketwelkaghkyfft
rnhstivafaigkrfvggngfhivgahtdspclklkpvskvvkggilevgvqtyggglwh
twfdrdltvagrvilkkenagsvsyshrlvrieepimrvptlaihldrgvndgfkvntqt
hllpilatslkaevnkvssenssvesgkkendktgssnakhhpillqllasklecepdei
ydfelqacdtqpsivagaakefvfsgrldnlcmsfcslkalidatssdssleeepgvsmv
alfdheecgsnsaqgagspvvldaisritesfspnskllekavqrsflvsadmahalhpn
ymdrheenhqpklhgglvikqnanqryatnavtsfifreiaskhnlpvqdfvvrndmacg
stigpilasgigirtvdvgapqlsmhsiremcavddvkysyehfkaffkefshldanivv
di
Download sequence
Identical sequences G7J514
XP_003602076.1.50012 Medtr3g088860.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]