SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr3g111240.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Medtr3g111240.1
Domain Number - Region: 15-63
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.0154
Family N-utilization substance G protein NusG, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr3g111240.1
Sequence length 68
Comment | DNA-directed RNA polymerase subunit beta, putative | LC | chr3:51981786-51982600 | 20130731
Sequence
MCPYNNIVLNPFYLNWYFLHHYYCEKTLIKESFKKVYQSINAMLRCSRPRVKILSIYKNK
WKMQFGER
Download sequence
Identical sequences G7J446
XP_003603695.1.50012 Medtr3g111240.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]