SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr3g115290.6 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g115290.6
Domain Number 1 Region: 37-241
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.09e-38
Family Pancreatic carboxypeptidases 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr3g115290.6
Sequence length 247
Comment | zinc carboxypeptidase family protein | HC | chr3:53912181-53907394 | 20130731
Sequence
MADLLSLSLILFFYFLLSSSQDLFLFVHAESNNNLTVTPINYDLYHSSGSLMHEIKALVH
RHPNKFSMETVKAGNKGYGAEIAVVTYCKGKRDSPEKPKLRILLSFGQHGRELITSELAL
RILSILSEEKLLPGMDQASLNSILDKVVIKVVPMENLNGRKLVEAGDLCERRNGRGVDLN
RNWSVDWGKKEKDYDPYEENPGTAPFSEPESQIMRKLAVSFEPHIWVNVHSGMEVCLVNF
SPFLKIK
Download sequence
Identical sequences A0A072VDS2
Medtr3g115290.5 Medtr3g115290.6 XP_013462270.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]