SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr3g118550.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Medtr3g118550.1
Domain Number - Region: 73-149
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.000204
Family N-terminal domain of MutM-like DNA repair proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr3g118550.1
Sequence length 196
Comment | hypothetical protein | LC | chr3:55496357-55494120 | 20130731
Sequence
MRLLKMLASPFVLALPLTLIFPCIKVDEMCALQKRSTWNLVPFLHSSYWWIFTIRVDPML
NWVVSRLKWWPNDILECLVSDGVSRSEFEAFVVSKKSFAACLKGKNTRIQLYSHPFPSFQ
LGMTGVLYIKDVDEDKWPCKLFIQLDDGLEVRTCKDPTLVFPIFELGLDTLFESMTPKEV
SDDRSGSEGCLTHDPE
Download sequence
Identical sequences Medtr3g118550.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]