SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr4g019060.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr4g019060.1
Domain Number 1 Region: 92-206
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.0000000000000994
Family N-utilization substance G protein NusG, N-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 273-324
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000662
Family N-utilization substance G protein NusG, C-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr4g019060.1
Sequence length 329
Comment | transcription termination factor NusG, putative | HC | chr4:5910011-5914601 | 20130731
Sequence
mkgmltlhlwnppprfytpslstkpplsisatsspelltakerrrlrnerresnatnwke
evenkliqktkkvnkswkdelnldnlmklgpqwwgvrvsrvkgqytaealarslakffpd
iefkvyapaihekkrlksgsisvkskplfpgciflrcelnkplhdyikeyegvggfigsk
vgntkkqinkprpvaeddmeaifkqakveqenadkafeeeekkaavnsgnpnkelesdvs
kaivdskpkrgsrktsnqltiteeassakkkpklvtgstvqiisgsflgfagtlkklnsk
tkmatvhftmfgkenivdldvseivpetn
Download sequence
Identical sequences G7JR97
XP_003604813.1.50012 Medtr4g019060.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]