SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr4g128400.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr4g128400.1
Domain Number 1 Region: 32-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.01e-84
Family Glycosyl hydrolases family 16 0.000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr4g128400.1
Sequence length 289
Comment | xyloglucan endotransglucosylase/hydrolase family protein | HC | chr4:53489852-53488164 | 20130731
Sequence
MASNYAFFVHVITSLICTIFIVAFAGNLYQDVGITWGDGRGKIVNNGQLLTLSLDRTSGS
GFQSNNQYLYGKIDMQIKLVPGNSAGTVTAYYLRSEGSLWDEIDFEFLGNLSGDPYIVHT
NVYTQGKGDREQQFYLWFDPTTSFHTYSFLWNPAHVVFSIDGRPIREFKNLESEGVPYPK
KQPMRLYSSLWNADDWATRGGLVKTDWNQAPFTASFRNFKANGCVLSNGISSCKSNSSSD
NAWLYQQLDSTNQKRLKWVQKNYMIYNYCNDLKRFPQGLPLECIVRTNS
Download sequence
Identical sequences G7JVH9
Medtr4g128400.1 XP_003610141.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]