SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr4g130860.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr4g130860.1
Domain Number 1 Region: 248-564
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.82e-109
Family Leucine aminopeptidase, C-terminal domain 0.000000257
Further Details:      
 
Domain Number 2 Region: 65-249
Classification Level Classification E-value
Superfamily Macro domain-like 1.71e-26
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr4g130860.1
Sequence length 567
Comment | cytosol aminopeptidase family protein | HC | chr4:54531815-54526382 | 20130731
Sequence
MAAIASAIVIAFSKSSSSSLFLTSRIRFASFPKRSFHSTTKLMSQSRYTTLGLTHPTNIE
APKISFSATDVDVTEWKGDILAVGVTEKDLTRDAKSRFENSILNKIDLKLDGLLSEASSE
EDFSGKVGQSTVVRIKGLGSKRVGLIGLGQLPSTTALYKGLGEAVVAVAKSAQASNVAIV
LASSEGLSSESKLSTAYAIASGAVLGLFEDQRYKSESKKPAVRSIDIIGLGTGPDLEKKL
KYAGDVSSGIIFGRELVNSPANVLTPGVLAEEASKVASTYSDVFTAKILDADQCKELKMG
SYLGVAAASANPPRFIHLTYKPPSGSVKVKLALVGKGLTFDSGGYNIKTGPGCSIELMKF
DMGGSAAVLGAAKALGQIKPLGVEVHFIVAACENMISGTGMRPGDVVTASNGKTIEVNNT
DAEGRLTLADALVYACNQGVEKIIDLATLTGACVVALGPSIAGVFSPNDELVKEVLEASE
VSGEKLWRLPIEESYWESMKSGVADMVNTGGRPGGSITAALFLKQFVDEKVQWLHIDMAG
PVWNDKKRSATGFGVSTLVEWVLKNSS
Download sequence
Identical sequences G7JGP9
XP_003610319.1.50012 Medtr4g130860.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]