SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr5g016830.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Medtr5g016830.1
Domain Number - Region: 561-729
Classification Level Classification E-value
Superfamily Tropomyosin 0.00497
Family Tropomyosin 0.0054
Further Details:      
 
Domain Number - Region: 506-567
Classification Level Classification E-value
Superfamily BRCA2 helical domain 0.0785
Family BRCA2 helical domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr5g016830.1
Sequence length 849
Comment | filament-like plant protein | HC | chr5:6081942-6085769 | 20130731
Sequence
MDQKQWEWGKKTREKTILETDKANLTSYENEEVQALLSDKEKLEKELKRLNDKLVFTLSE
CNAKDDYMKKQTKIVQEAVSGWEKAEAEMLSMKEHLEESIHQELIYEERVAHLDRTLKEC
MRQLHFVREEQEQRIYDAVMKVSVEFDQARVVLEEQLSEKSKRLAKTVIENSYLNKSIIA
KDNLIDDLRRQLNQADVDRNALMIGLESVEKDNTSLMYEARVLQKELDIRNEVQFSRVML
SQTASKLLQLESEIDSKNQVASEQPRSHVALQELSLASMSYIGSDDNVSCGESLASALIS
ESERFKSPKHLGSLSCKSFGPSDINLMDDFIEMEKLAVVSVEKATEISHASVEANNEIIG
FSETILDEISPLSDSDHISEFAASNPETCSSDIFKGNIPGWFQDVVRVVLEQNCVTDFNP
DDVLEDIKLAIKHLNDPDQRALDSGKDYCQFDPSNAETSLIKRARTQCQKDLNKSIGKMI
ELIEGINMPVDDNDNSNPFMVRAFQWKTSDFRDVLQKFLNMCYSILDGKADHERFATELT
TTMEWIINHCFSLWDVSSMEDAIKKKFDWDETQSENEAKVGMCTDAEKLQADTSRFQELE
NTIANLRLELQTLKESNRRLEDQIQNEKSLSRYLDTQLTETELKEAYHKILALEVELESK
NHFCEELDTKCVELQLQLESTKRARSNGYVNQKNELVRNEWEITAASEKLAECQETILNL
EKQLKAIAATTDVSIFNNIIAAHRRPIITNTTSVSVPLKDKVKNRPSLLDQMLAEDEAKA
KFCKTSERNFIQPLEKIVVLKGLKGRDDDVNVNSLAILPAKKYGRLSLWKRMLGTRTKPK
RKQVYQFNK
Download sequence
Identical sequences G7K5B5
Medtr5g016830.1 XP_003611694.2.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]