SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr5g058430.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr5g058430.1
Domain Number 1 Region: 6-128,263-348
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.71e-42
Family Bacterial dinuclear zinc exopeptidases 0.0000109
Further Details:      
 
Domain Number 2 Region: 132-238
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00000882
Family Bacterial exopeptidase dimerisation domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr5g058430.1
Sequence length 355
Comment | N-acyl-L-amino-acid amidohydrolase | HC | chr5:24148014-24156148 | 20130731
Sequence
mglgshpslpsillnshldsvpaepskwlhppfsavrdadglifargaqddkciamqyle
airslnskgfvpvrtvhislvpdeevggfagwamfvesdefekmnvgfaldegqasvgde
frvfyadripwnlkikatgqpghgsrlyddsamenlmksvevvsrfresqfdvvkagkal
nsevvsvnpvyvkagvpthdgfvmnvqpseaeagfdlrltpttdpdemkrriaaewapsv
rnmsfeiiekgplrdclghplmtatndsnpwwlvfkqaiasageklsrpeilasttdary
irqkgipvlgfspmkntpillhdhnehlrdtvymkgiqvyeslisslssfleash
Download sequence
Identical sequences G7K8S5
Medtr5g058430.1 XP_003614736.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]