SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr6g033115.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr6g033115.1
Domain Number 1 Region: 128-258
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.2e-37
Family Single strand DNA-binding domain, SSB 0.00015
Further Details:      
 
Domain Number 2 Region: 261-290,408-484
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.11e-21
Family Single strand DNA-binding domain, SSB 0.01
Further Details:      
 
Domain Number 3 Region: 291-408
Classification Level Classification E-value
Superfamily BRCA2 tower domain 9.02e-19
Family BRCA2 tower domain 0.0026
Further Details:      
 
Domain Number 4 Region: 16-127
Classification Level Classification E-value
Superfamily BRCA2 helical domain 6.02e-17
Family BRCA2 helical domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr6g033115.1
Sequence length 614
Comment | breast cancer type 2 susceptibility-like protein | HC | chr6:10433073-10439288 | 20130731
Sequence
MRGSYGLSKLSSGASGCKRKVSTRYPSRHARIHIKEFFAVPPLKKKVHFPNPVRQVTSGN
AGEYIFHDGSDDNGIGGEAFIHLLAQHGASLHLVAFILARCAGKFLTVSNVLEELKYRYE
REVNHGHRSIIKKVLEEGDILPSSMMILCISSIHSNHVMESGTLFQAQTGNKSREAVKVE
LTDGWYSINAILDAPLSKQLDAGRLFVGQKLRIWGAELCGWNGPVSPFEVSSTISLFLHI
NGTYRVHWSARLGFCKVAGPPLAFKCIKNNGGLIPQTLAGITHIYPILYKERLSSERSVV
LSERMENKMMELHNQRRSAVVDNIVSEYQKERTSSHVYDHDDSEGAKIYMMLETAAEPEF
LMADMTPEQLRSFAAYKAKLNATRQSQMESSIEKALKDSGLGNRDVTPFMRLRVVGLTYK
NCQDKSKEGIVTIWNPTQKQCQELAEGEAYAIAGLTPYGSDSDVLRFQTRGSTTKWLPLS
SNARNSLVHFSIVGNQSHCQVCVTSLFPSQQKKQWVFVTDGSIMKGLQSEKFTDTLLAIF
FCSPLIDHDSFPPINHNLAGSTVGFCNLIKKEKDHTYQIWVADANENSTYYLKFDSSHCS
FSSQKSCQFRHKMG
Download sequence
Identical sequences A0A072U8B6
Medtr6g033115.1 XP_013451598.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]