SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr6g088825.3 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr6g088825.3
Domain Number 1 Region: 45-82,309-544
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.44e-72
Family FolH catalytic domain-like 0.0000121
Further Details:      
 
Domain Number 2 Region: 88-327
Classification Level Classification E-value
Superfamily PA domain 9.29e-62
Family PA domain 0.0000205
Further Details:      
 
Weak hits

Sequence:  Medtr6g088825.3
Domain Number - Region: 546-598
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 0.000157
Family Transferrin receptor-like dimerisation domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr6g088825.3
Sequence length 611
Comment | peptidase M28 family protein | HC | chr6:33979536-33985689 | 20130731
Sequence
MIKTSIIITLLAIATSYLLLTPTKKSSYYHSLFISNSLSDNVSVSNNLKVLTHRPHIAGS
EANNEAAAYVVSILTSSNIPTHVTSYDVALAYPFSRSLVLTNSSTESSFSFNLRQESYEG
DPYADVIDEVVPTFHAYAKSGTAIGYVVYANYGRVEDYLKLKEMGINVSNTVVLAKYGKV
YRGDIVKNAYNEGAIGVVIYSDKKDNGGSDEAKWFPNEKWLPPSGVQIGGVYSRVGDPTT
PGWASCGECERLSMDEVEKGGDVPLIPSLPVSGEDGEKIIRSIGGPVAEDDWQGSKDAPT
YRVGPGPGILNLSYTGQQVIATIQNVIGVIEGAEEPDRFVILGNHRDAWTFGAVDPNSGT
AALLEVAQRLGKLQKKGWKPRRTIILCNWDAEEYGIIGSTEWVEENREILASRTVAYLNV
DSAVGGPGFRASATPQLEELIIKATQKVKDPDNSSQSIYDSWTDSNSSPQFGRLGGRVSD
YAPFLQHVGIPAADIAFGKGYPVYHSQYDDFVWMTKFGDPVFQRHVAAASVWGLVALWLA
DEEFLPFNYSSYAKELQLSMESLKNEISNEDIINLSPMYKSIKELEKAATKINEQIKVCI
KYLNTWPLIII
Download sequence
Identical sequences A0A072UDN2
XP_013453195.1.50012 Medtr6g088825.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]