SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr7g075660.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g075660.1
Domain Number 1 Region: 2200-2491
Classification Level Classification E-value
Superfamily BEACH domain 3.14e-124
Family BEACH domain 0.0000000115
Further Details:      
 
Domain Number 2 Region: 2615-2682,2719-2833,2869-2916
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.81e-26
Family WD40-repeat 0.0075
Further Details:      
 
Domain Number 3 Region: 2078-2187
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-22
Family PreBEACH PH-like domain 0.0018
Further Details:      
 
Weak hits

Sequence:  Medtr7g075660.1
Domain Number - Region: 464-606
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000174
Family SO2946-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr7g075660.1
Sequence length 2945
Comment | WD-40 repeat protein/beige protein | HC | chr7:28381508-28350580 | 20130731
Sequence
MEEEDEPKEMKISGNELDSHGVVDSDLKRFVESPHEENVNGSSSFEVEHVDERVHLQDQD
VQCATTVMSEDQFEQVSLKDQDKNNESEYSNQSPGSDKIHRPYDGYAEDSRYSSGSCSIE
YDSSIVADLHLDNLSYSPGSEDKQFAPSFSFDSTGYSSVKSPPNPRQKHAKPNVSPELLH
LVDSAIMGKPEGIDKLKNIASGVEIFESGEEMDSVPFLIVDSLLATMGGVESFEEDEDNP
PSVMLNSRAAIVSGELIPWLPYIGDTDDVMSPRTRMVRGLLAIIRACTRNRAMCSSAGLL
GVLLRTAEKIFTVDVGLNGQMRWDGTPLCHCIQFLAGHSLSVSDLYRWFQVITKTLTTIW
APQLTLALEKAISGKESRGPASTFEFDGESSGLLGPGESRWPFVSGYAFATWIYIESFAD
TLNTATVAAAIAAAASARSGKSSAMSAAAAASALAGEGTVHMPRLFSFLSGDNQGIEAYF
HAQFLVVETASGKGKKSSLHFTYAFKPQCWYFIGLEHIGKHGILGNTESEVRLYVDGSLY
ESRPFEFPRISKPLAFCCIGTNPPPTMAGLQRRRRQCPLFAEMGPVYIFKEPIGPERMAG
LASRGGDILPSFGNAAGLPWLSTNAYVHSKAEESVLLDAEIGGCIHLLYHPSLLNGRFCP
DASPSGASGVLRRPAEVLGQVHVATRMRPGDALWALAYGGPLSLLPVTISNIDEDTLEPL
QGNLSLSSATTSLAAPIFRIISIAIQHPRNNEELSRGRGPEVLSKILNYLLQTLSSLDVG
KHEGVGDEELVAAVVSVCQSQKINHTLKVQLFATLLLDLKIWSLCSYGIQKKLLSSLADM
VFTESTVMRDANAIQMLLDGCRRCYWIVREIDSVDSFSLAGATRPVGEINALVDELLVVV
ELLIVAAPPSLVSADVRCLLGFMVDCPQPNQVARVLHLFYRMVVQPNASRANTFAEEFLA
GGGIETLLVLLQREAKAGDSGVMESSSKNPELEKTEIDGSNENTERSQDDEGSEDKRSQS
VDSGNSPHHSSPDINSDRMAFASETSSVKNLGGISLSISADSARKNVYNIDKSDGIVVGI
IGLLGALVASGQLRFVSCASPDTTSNLYGVGLHDRGGTMFEDKVSLLLYALQKAFQAAPN
RLMTNNVYTALLAASINASSLEDGLNFYDSGHRFEHSQLLLVLLHSLPFAPRSLQSRALQ
DLLFLACSHPENRNSMINMEEWPEWILEILISNYEVGSSKLSDSTSVGDVEDLIHNFLII
MLEHSMRQKDGWKDIEATIHCAEWLSIVGGSSTGEQRVRREESLPIFKRRLLGVLLDFAA
RELQVQTQIIAAAAAGVAAEGLSPTDAKAEADNAAQLSVALVENAIVILMLVEDHLRLQS
KQSSSRTADISPSPLTTLYPISDHSTSLSTIDESAEEVADSRSSLSGGSGGNPLDALSSM
ADGTGQIPTSVMEKIAAAAAAEPYESVSCAFVSHGSCAKDLADGWKYRSRLWYGVGLPQN
PAAFGGGGSGWDFWKSTLEKDANGNWIELPLVRKSVAMLQALLLDESGLGGGLGIGGGSG
TGMGGMAALYQLLDSDQPFLCMLRMVLLSMREDDNGEDYMLMRNTSIDDAASEGRKPRSA
LLWSVLSPVLNMPISDSKRQRVLVASCVLYAEVYHAVSRDQKPLRKQYLEAILPPFVAVL
RRWRPLLASIHELATADGLNPLVADDRALAADSLPIEAALAMIAPAWAAAFASPPAAMAL
AMIAAGASGGESQAPAQTSHLRRDTSLLERKQTRLHTFSSFQRPLEVSNKTPPLPKDKAA
AKAAALAAARDLERFAKIGSGRGLSAVAMATSAQRRSASDMERVNRWNVSEAMGVAWMEC
LQPVGTKSVYGKDFNAFSYKYIAVLVASFALARNMQRSEVDRRAYVDIVTRHRISTGVHA
WRKLIHQLIEMRSLFGPSADNLYSPLRVFWKLDLMESSSRMRRCLRRNYQGSDHLGSAAD
YEEYSEEKKDQSTPILSAEAISLEAVNEDEEQVDAENLVDRVDDVQNKGDNQLSISESAE
QSVQASLESSSPQHASDEHIDQSSSAIAPGYVPSELDERIVLELPTSMVRPLKVIRGTFQ
VTSRRINFIVDNNSNETSAATDGFHSSFEAGNQEKDRSWLMSSLHQIYSRRYLLRRSALE
LFMVDRSNFFFDFGSSEGRRNAYRAIVQARPPHLNNIYLATQRPDQLLKRTQLMERWARW
EISNFEYLMQLNTLAGRSYNDITQYPVFPWILSDYNSESLDISNPSSFRDLSKPVGALNP
DRLKRFQERYASFDDPLIPKFHYGSHYSSAGTVLYYLVRVEPFTTLAIQLQGGKFDHADR
MFSDISGTWNGVLEDMSDVKELVPELFYQPEVLTNENSIDFGTTQLGGKLDTVKLPAWAE
NPIDFIHKHRKALESEYVSSHLHEWIDLIFGYKQRGKEAVAANNVFFYITYEGTVDIDKI
SDPVQQCATQDQIAYFGQTPSQLLTVPHLKKMPLAEVLHLQTIFRNPNEVKPYVVPSPER
CNLPAAAIHASSDAVVVVDMNAPAAHVAQHKWQPNTPDGHGTPFLFQHRKVTAGSAGGAL
MRMFKAPVSSGEEWRFPQAVAFSASGIRSQAIVSITCDKEIITGGHADNSIRLISSDGAK
TLETAYGHCAPVTCLGLSPDSNYLVTGSRDTTILLWRIHRALVSHSNVVSEHSTGTGTLS
PTSNSSSHLIEKNRRRRIEGPIQVLRGHRSEIISCCVNSNLGIVVSCSHSSDVLLHSIRR
GRLIRRLDGVEAHIVCLSSEGVVMTWNESQHSLSTFTLNGTPIARAQFSFFCSISCMQIS
NDGMSALIGINSQENGSSLNSQLNKSGVDFDSESEETDENSRTDLPSPSICFLDMHTLEV
FHILRLGEGQDITALTLNQDNTNLLVSTLDKQLIIFTDPSLSLKVVDQMLKLGWEGNGLQ
PLIKS
Download sequence
Identical sequences G7L1D4
Medtr7g075660.1 XP_003623785.2.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]