SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr7g107100.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g107100.2
Domain Number 1 Region: 57-99,302-537
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.39e-71
Family FolH catalytic domain-like 0.0000375
Further Details:      
 
Domain Number 2 Region: 105-320
Classification Level Classification E-value
Superfamily PA domain 2.35e-44
Family PA domain 0.00012
Further Details:      
 
Weak hits

Sequence:  Medtr7g107100.2
Domain Number - Region: 539-587
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 0.000107
Family Transferrin receptor-like dimerisation domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr7g107100.2
Sequence length 590
Comment | glutamate carboxypeptidase, putative | HC | chr7:43671752-43677558 | 20130731
Sequence
MTTKPNNLLTTKPSPLTTMVVFLILCILGFYAFHFPHTPPHSNNTSTFQNLFLSSSSNST
ISSYLRTLTMHPHLAGTKPNSDTANFVLNHFISLNLKTHTTSYNVLLSYPLHSSLSMHFN
DGSSSNLGLTEPGSSGSDMVHAYHAYSPSGSVYAKAVFVNYGRDRDYRAVGVSIKGCIVI
VRKGGGLGRNTVVEKAEENGAVAVLVYNDENDTWRNGFERGHVMKGVGDPLSPGWGSVEG
SEKLSLDDNEVLKRFPKIPSMPLSAHVADAVLSSLGVTPLPLEWRTTLRAKGINHVGPGP
TMLNFTYLGEKKMATIQNVFAVIKGSEEPDRHVLLGNHRDAWTYGAVDPSSGTAALLDIA
RRYSILLHSGWKPRRTIVLCSWDAEEFGMIGSTEWVEQNLINLGSKAVAYLNVDCAVQGP
GFFVGSTPQLDSLILEITKKVKDPDSKGVSVYASWAAANGGNNIQRLGRVDSDFAPFVQH
AGVPSIDIYYGKDFPVYHTAFDSYNWMAEYADPFFQRHVAVTGIWGLLALRLADDSILPF
NYLSYANELRLYRDKLSNMLDHKMSLHPLTTSIQEFACAAKEVDDELKVK
Download sequence
Identical sequences A0A072UEU7
Medtr7g107100.2 Medtr7g107100.5 XP_013450282.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]