SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr7g114900.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g114900.1
Domain Number 1 Region: 48-190,221-231
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 5.39e-40
Family D-ribose-5-phosphate isomerase (RpiA), catalytic domain 0.0000491
Further Details:      
 
Domain Number 2 Region: 181-261
Classification Level Classification E-value
Superfamily D-ribose-5-phosphate isomerase (RpiA), lid domain 1.12e-17
Family D-ribose-5-phosphate isomerase (RpiA), lid domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr7g114900.1
Sequence length 280
Comment | ribose-5-phosphate isomerase A | HC | chr7:47437147-47436305 | 20130731
Sequence
MASLSLSSPPSLSSSFFNASSRLNLRTPSSLKLRTKPLSFSVKAITLTQDDLKKLAADKA
VEYVKSGMVLGLGTGSTAAFVVSKLGELLNSGELTNIIGVPTSKRTEEQARSLGIPLSVL
DDNPRLDLAIDGADEVDPFLNLVKGRGGALLREKMVEAASDKFVVVVDDTKLVSGLGGSG
LAMPVEVVQFCWKYNLIRLQELFKEEGVDAKLRVDESGKPYVTDNSNYIVDLYFKTPIRD
ANAAGAEISSLEGVVEHGLFLNMATSVIIAGKTGVEVKDK
Download sequence
Identical sequences G7L1U4
Medtr7g114900.1 Medtr7g114900.2 XP_003626424.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]