SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr8g062090.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr8g062090.1
Domain Number 1 Region: 72-110
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0000000977
Family Bacterial exopeptidase dimerisation domain 0.00074
Further Details:      
 
Domain Number 2 Region: 28-86
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.00000907
Family Bacterial dinuclear zinc exopeptidases 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr8g062090.1
Sequence length 115
Comment | transmembrane protein, putative | HC | chr8:25928834-25928369 | 20130731
Sequence
MHIIFFFPSYLVLLFFILLWIHDIIPYFVQGNVVLVFQPAEEGGPAEEGGVGAKKILDPG
ILENVSRHVVGGGHGAIPHHVLNPILAASNVTISLQQIVSREVDPIDSQVKAYNS
Download sequence
Identical sequences G7LDU2
XP_003628574.1.50012 Medtr8g062090.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]