SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr8g062790.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr8g062790.1
Domain Number 1 Region: 48-231,336-425
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.11e-79
Family Bacterial dinuclear zinc exopeptidases 0.000000547
Further Details:      
 
Domain Number 2 Region: 231-334
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 4.19e-18
Family Bacterial exopeptidase dimerisation domain 0.0000761
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr8g062790.1
Sequence length 433
Comment | IAA-amino acid hydrolase ILR1-like protein | HC | chr8:26262483-26266262 | 20130731
Sequence
mmdlnnhirlalllifmclsinfeanecsnqtsslknqilevannpntvkwmkqirreih
eypelgyeefrtssvirreldklgisyqwpvaktgvvakigsgfppfvalradmdalpiq
elvdwdhkskvdgkmhacahdahvamllgaakilqemknklkatvvlifqpaeekgigar
dmiqenvledveaifglhlatqyplgvvasrpgdflagcgsfkakikgglaeipqhcldp
vlaasmsvislqnivsrevdpldsqvvsvamvhsesahelipdsvtfggtyraiskksfn
alrqrieevikgqakvhrctaeveffgkehptippttnderihqlgrqassmivgeenik
laptytasedfafylekvpgsffllgiqnekvgsiysahsphyfidedvlpigaaihaaf
alsyhshstisyl
Download sequence
Identical sequences G7LER0
XP_003628629.1.50012 Medtr8g062790.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]