SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr8g080470.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr8g080470.2
Domain Number 1 Region: 41-331
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.71e-48
Family Bacterial dinuclear zinc exopeptidases 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr8g080470.2
Sequence length 742
Comment | endoplasmic reticulum metallopeptidase-like protein | HC | chr8:34608247-34602090 | 20130731
Sequence
MAFGFGSSEDVSAFKFLFIMAVGYGLVSMLTYSVIHMKFIVPLHNDAPLDRFSEGRAIQH
VRVLSHEIDGRHEGRPGLRKAAEYIKSELELIKERATSNVRIEIEESTVSGSFNMNFLRH
NIALGYRNHTNIVMRISSIDSKDTDPSVLVNGHFDGPLGSPGAGDCGSCVASMLEIARLI
VDSSWVPHHPVIFLFNGAEELFMLGSHGFMKTHKWHDMIGAFINVEASGTGGPDLVCQSG
PSSWPSNIYAEAAIYPMATSAAQDVFPIIPGDTDYRIFSEDYGSIPGLDIIFLLGGYFYH
TSYDTVEQLLPGSIQARGENLFSIIKAFTDSSKLQNRYQTNYSEVRASLFNEERAIFFDY
LSWFMIFYSKRVAKILHSVPIFLFFVMSFTRGWSNSCVATLCDFVKGFLFHAVGIILAVI
VPVAFSLLRLPFSSQTMNWFAHPFLAFIMFIPCALVGLIIPRIIWKCFPLSQDAAIVKRS
KEALSDEARFWGAFAFYAVLTLAYLVAGLSGGFVTFVASACMLPSWISYCLSVKSFGRRS
FRSTIFYLLPLVPCLAYAVYFGGFLAQFLIEKMGMMGSLPLPYGHYVPDIIVAAIIGLVT
GWSVGPIMPICGHWLARSSIVRFLLHLSVLGLAISSQFFPYSMSAPKRVVFQHTFRTAGS
SQITESTYDLSVLDSNSLLFIFKHSPEVAKILNITPEFLFESAPLSERHDWMVVLCQYPV
NLLGLNAIFTSYVSKSCNFGPL
Download sequence
Identical sequences A0A072TTS1
Medtr8g080470.2 XP_013446564.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]