SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr0010s0310.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr0010s0310.1
Domain Number 1 Region: 150-237
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000883
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr0010s0310.1
Sequence length 251
Comment | hypothetical protein | LC | scaffold0010:225651-227410 | 20130731
Sequence
MALPPHMVDIPEGSNLFERTFETVVVPDSKSDLAAQKYGWIKDPAGNYIRIDLSNVVRQN
IIPSCLIISRICGFVEPQRVILCYQILDNQFNMRIVDDADEEVGLAIPAEMFNTMVVDNG
GNVAVEARLNIPNPDLPIHIPGGDGVAEEYIWTLKVTQPIADGRSVLHFPRFVIENFTFS
VGPEIHVMDDATGEMFTCMIKTANTPSGYVVKYLARGWYQFVRSKELSVGDHIVFGVQNP
VKSIDKLLLSH
Download sequence
Identical sequences A0A072TVE9
XP_013443485.1.50012 Medtr0010s0310.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]