SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g019580.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g019580.1
Domain Number 1 Region: 33-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000018
Family B3 DNA binding domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr1g019580.1
Sequence length 131
Comment | transmembrane protein, putative | LC | chr1:5933385-5932901 | 20130731
Sequence
MNFRVHRIAVPVTPDWVVPRPFVHDVFNFQLTYEKIMSLYDVTAGYLKLAEFCFAHMALD
RETMVIDLVDENGNVWNCSLQFSETPYADFKIGGGWERLVQARRIKEGACVVVGAPGVGM
NLTLFFCVIRR
Download sequence
Identical sequences G7I3L8
Medtr1g019580.1 XP_003589202.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]