SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g021270.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g021270.1
Domain Number 1 Region: 477-578
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.1e-22
Family B3 DNA binding domain 0.0078
Further Details:      
 
Domain Number 2 Region: 10-109
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-22
Family B3 DNA binding domain 0.00093
Further Details:      
 
Domain Number 3 Region: 248-348
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-22
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr1g021270.1
Sequence length 596
Comment | B3 DNA-binding domain protein | HC | chr1:6335039-6339850 | 20130731
Sequence
mgreckgklnvrkphfyhlfnpsstsqslrvpdgfvhqmegatcglvsltgpsgntwqvr
lveqdnhlffhhgwstfvgdhhlqygdllvfryeghlhftvqvfgenacekeaafhsecn
lnsltfnniegqksdaemissldvvgdvqkkmrcdaienqepelaiagknqsnyelvrpi
smireteetckecsasavhvpfqtgnsnevedaailyrsgkeddhnilsgaslsklsahd
ekkiaqsftssfpyfvkiiktfnvsgsytlnvpyqfsmshfpncktkiilynlkgehwtv
nsvpttrvhtshtlcggwmafvrgnsikvgdvcifelirecelrvriaevgkdgldcqvg
klacsmlserhdvashntsrympkkpkvsskcrtkvdlsdkklskigqepvlaiefkksg
rasttskkmglspkskashkktavprkhrvedelssqakaglrmlfaldeqrvaeaftsp
fpnfvkimkkfnvsgsytlkipyqfsaahlpayktevtlrnsrgqcwivnsvpdakgrti
htfcggwiafvrdndinfgdtcifelvshyvmqvhisgvgkegldhqighaklnnm
Download sequence
Identical sequences G7I4K0
XP_003589266.1.50012 Medtr1g021270.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]