SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g021320.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g021320.1
Domain Number 1 Region: 499-599
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.73e-23
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 22-115
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-23
Family B3 DNA binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 723-825
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-23
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 4 Region: 183-272
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-22
Family B3 DNA binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr1g021320.1
Sequence length 842
Comment | plant-specific B3-DNA-binding domain protein | LC | chr1:6356167-6363567 | 20130731
Sequence
MGGAGGSSKSWEKEIYWTHFQFIHFIQFLQTTTDFQQQLALPKTFSDNLKKKLPGNVTLK
GPSGVVWNVGLTARDDTIYFTNGWQRFVKDHSLKENDFLVFKYNGESLFEVLIFHGDSFC
EKAASYFVGKCGQAHTEQVCNKGKSSNNSVEEVSTPSNGSVECSLPEKSWEEDIYWTHFQ
FIHFTQLLPEDFKQQLALPKTFSDNLNKKLPENVTLKGPGGVAWKIGLITRDDTVYFLNG
WQRFVNDHSLKDNDFLVFNYNGESHFDVLIFDGESFCEKEASYFVGKCSHTQTELGGSKA
NETNNSIEEVNTASSDGGVECGLYEKFQDLNNIGTPLAVPVETTNEKTFNAGVESDSPEL
LIADTVTKTTAIQFPYQPTGKRSKRRRSSTSANCCWRALDRVAYNKQHSVTIAVPSQTTG
QKTKKPVNEVTPGRSMKRGRQAKTATSGERSIDWVACNKENSEAANLNRSGKADGHDILS
GASLSKLSPHAEKEIAQSFTSSFPYFVKIMKTFNVERPRILNIPYEFSKDHLPNCKIKIT
LHNLKGEQWTVNSVPRTRLHASHILCGGWLNFVRGNSLKIGDVCIFELIGECELRVRINE
VGKDGLDSQVGKLACRLDVASHKTSRFMPKKHKISSKCCAEVDLLDKKLSEICQEAALSS
ELKKSVRASNTSKKAGLSPKSKASHKKPAVPRKHRIEDALSSQANDSLKMLFALDEQRVA
EAFTSPFPYFVKIMKKFNVCGSYTLKIPCQFSTAHLPARNTEVTLRNSRGKCWTVNSVPY
VQGETTIHTFCGGWNAFVRDNDINFGDTCIFELVSDYIMQVRISGVGKEGLDHQNGNVKL
TS
Download sequence
Identical sequences G7I4K4
Medtr1g021320.1 Medtr1g021320.2 XP_003589270.2.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]