SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g021500.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g021500.1
Domain Number 1 Region: 296-378
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000589
Family B3 DNA binding domain 0.0074
Further Details:      
 
Domain Number 2 Region: 22-95
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000011
Family B3 DNA binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr1g021500.1
Sequence length 491
Comment | plant-specific B3-DNA-binding domain protein | HC | chr1:6438573-6443179 | 20130731
Sequence
MGLQNGGGCSRSWEEDIYWTHFQFIHFTQFLRSNDFDQQLALPKTFSNNVKKKLPENVVL
KGPGGVTWNIGLTSRDGTFYFTQGWEQFVKDHFFERERLPFSVEKAAAYFVRKCGHAEAA
AQTEQGGGCSSKGRETNNSVDEVNTPSNGVDEGVSHEKSLHLNSIRVPFAVPSETTNGKT
SNAAVESATPEQLMSDAAVTETEPTAVPSQTTGKRTRRPVYAVPSVPSKKRGRPPRTSNS
QEKALNWVTDAGPAPASPKGSPKTQELYTSNRRPVTKDEIEKTLQVAQAACTEESLLVTM
RPSHVYKRFFVSFPNKWILNHLAPSSQDVILRMGKNEWLGKYCYHNIRNNGGLTGGWKYF
ALDNNLEEFDVCLFKPAGHLHDILILEMSIFRVVEEITPLTAVHSPGKKRGLSSTGKKRG
VKRTLTSAAQTELEAIEGAETDDQGLQQADDDELLSQIRAKRNIVKSSKYLKDYVIPKKK
TSLDLEGTSAS
Download sequence
Identical sequences G7I584
XP_003589285.1.50012 Medtr1g021500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]