SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g033740.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g033740.1
Domain Number 1 Region: 20-109
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000785
Family B3 DNA binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr1g033740.1
Sequence length 195
Comment | hypothetical protein | LC | chr1:12194798-12193168 | 20130731
Sequence
MSFQQHTTIYHGRGSHAKGMHFYQTIQLPELQHQELMIPRNFVERYWKDVSNPISLRLPN
ESECKMFWVQRGDDIWLMNWKNFARSLRCGDLLVFQYNGGSDFHIIILDDSKLEIDYSSM
KCNGEENSNQVCKQEESDDDDCVEIPNDIVTPAATPQRTNIDKRKINMNSTQQKVSGKFI
YVIRFIYLFVAKICF
Download sequence
Identical sequences A0A072VFY6
Medtr1g033740.1 XP_013466676.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]