SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g035460.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g035460.1
Domain Number 1 Region: 192-288
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-22
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-17
Family B3 DNA binding domain 0.0076
Further Details:      
 
Weak hits

Sequence:  Medtr1g035460.1
Domain Number - Region: 347-390
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.012
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr1g035460.1
Sequence length 396
Comment | plant-specific B3-DNA-binding domain protein | LC | chr1:12873695-12875594 | 20130731
Sequence
MIPKGFTRDHMSDMLNPVFLKTPDGKKWEMCTTKINGDIWFQKGWKEFATYYSLDHGHMV
LFQYEENSHFVVHIFSKSTLEIEYPFHGNQHEQNNFDQQSSDEDSIEILDKSPSCKKKTR
PKSPIMCPQPHKKLRSDSSEGVGTSSRFQNLPKHHVQSSEDTGASAEFRKVKHELEQEQY
QEQEQLNRVRSFKSNNPSFRITMKSSHIYSHSLYVPSQFANNHMKKEQSDILLQLLDGRV
WDAKYCSAKINGGWKKFAVHNKLKIGDVCIFELTKSQYLTLKVIIFRLEEDPHSPSPQES
IQRDKDFSDVESETIMTNKEEKATQKTSLRTKAEFLTNEAENQADKFKSKYPFFKVDIMP
NQRGHSRLLVPNSFITNYLDNKEQMVMLKFGKKLWL
Download sequence
Identical sequences A0A072VGT1
XP_013466755.1.50012 Medtr1g035460.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]