SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g045720.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g045720.1
Domain Number 1 Region: 145-250
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000167
Family B3 DNA binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr1g045720.1
Sequence length 259
Comment | E1 protein | LC | chr1:17185531-17184752 | 20130731
Sequence
mamashnnnvvatlsscnnkpyddhahtnnkrkrdhaslenrkrrrnnnsrkltfnpyqh
dtndvclclslscrhrtattthddekkktcnddstvgkhnnlkllqpihdstvclhflls
tpscgcdqiateqklggqeidavndqqweikkfltksdicpglirlmlnkdladkfiiph
llggaeaarkkegvqvkvwdfdekelhslvfkiwasdkyyvftktwieefvkrrklnkgd
qiglrwdqlnnrfdfsvlh
Download sequence
Identical sequences G7I6Q4
XP_003590187.1.50012 Medtr1g045720.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]