SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g045740.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g045740.1
Domain Number 1 Region: 145-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000942
Family B3 DNA binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr1g045740.1
Sequence length 268
Comment | E1 protein | LC | chr1:17194915-17195721 | 20130731
Sequence
mamashnnnvvatlsscnnkpyddhahtnnkrkrdhaslenrkrrrnnnsrkltfnpyqh
dtndvclclslschhrtattthddekkktcnddstvgkhnnlkllqpihdstvclhflls
tpscgcdqiateqklggqeinavndqqweikkfltksdicpglirlmlnkdladkfiiph
llggaeaarkkegvqvkvwdfdekelhslvfkiwasdkyyvftktwieefikrrklnkgd
qiglrwdqlnnrfdfsvlhreilvcnss
Download sequence
Identical sequences G7I6Q6
XP_003590189.1.50012 Medtr1g045740.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]