SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g046550.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g046550.1
Domain Number 1 Region: 151-260
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000135
Family B3 DNA binding domain 0.0057
Further Details:      
 
Weak hits

Sequence:  Medtr1g046550.1
Domain Number - Region: 113-168
Classification Level Classification E-value
Superfamily Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin 0.00875
Family Plant lipid-transfer and hydrophobic proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr1g046550.1
Sequence length 264
Comment | E1 protein | LC | chr1:17539226-17538432 | 20130731
Sequence
MASHTSNNFVGSHLSVTTHGDHVTKTKPTNKRKRDVSVGKRRRNNTLGKLTSSSYLPASL
HDTNNLCLCLSLSCLHTTTHDHETSQITKKKKKTCNYEAFVGKQNNLGLLQPIDDLSVCL
HFLVGSPSCVPTCCHDHEQTTKKTPCNADEQQLWEIKKVLETSDICKHKTRLLLNKDLAE
KFVVPVLLDGAFGKGGVQVQVWDIDTKSPHSVVFKYWPSAKSYVFTNTWTKEFVNRRELK
KDDQIVLRWDRNNQRFDFSVLKKP
Download sequence
Identical sequences A0A072VIB9
XP_013467162.1.50012 Medtr1g046550.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]