SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g047540.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g047540.1
Domain Number 1 Region: 41-115
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000628
Family B3 DNA binding domain 0.0083
Further Details:      
 
Domain Number 2 Region: 159-236
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000412
Family B3 DNA binding domain 0.034
Further Details:      
 
Weak hits

Sequence:  Medtr1g047540.1
Domain Number - Region: 322-437
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.0326
Family Bacterial dinuclear zinc exopeptidases 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr1g047540.1
Sequence length 486
Comment | hypothetical protein | LC | chr1:17972009-17974903 | 20130731
Sequence
MPNRDVETLLSYHTLTEPLDPNHVDEFSKIVNDLRQKYRTYVVGFDVEHGVVLLPSMFCH
DFGDQLDRLATLVDGNGNEFEVYVEKHKSGVYLTRGWHALRDFYKLTLGSWISMVWQKIR
NPVFTPSMKFMIDRSWLPFQMMDAVPTPYAQDEMSFQFSYEKRLTSDEIKSGWLVLAFGG
FCALTLDKITTSLKLVDDYGNKWMCTLVYGTIPYRHFKIGGGWKKVVDVRGITGGCHVMI
CAPADGMNETLYFRTIANYEWCKIVFCELAQIIFLSYQINFYQDPWLRSEYGNWLPAPQN
QGVYDLFLSDLLIDGVKEWDVDKIAELFSSEGDKVVWQEESNGLYSVRSGNRIAARDIIM
SSHYYVQGGWNAIWKVKAPHKRHVSCTNRCLWCDGDEGTNWHAFVACDVARESWFSYGLS
VESADTGGCVVVLLWQLWTAKSDVVWNSSCHTLLGIGRLALSNLQQWKLAQEMNRSGRST
APALPA
Download sequence
Identical sequences A0A072VHH3
Medtr1g047540.1 XP_013467228.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]