SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g054495.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g054495.1
Domain Number 1 Region: 123-211
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000942
Family B3 DNA binding domain 0.011
Further Details:      
 
Weak hits

Sequence:  Medtr1g054495.1
Domain Number - Region: 30-100
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0373
Family B3 DNA binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr1g054495.1
Sequence length 230
Comment | hypothetical protein | HC | chr1:23575219-23574252 | 20130731
Sequence
MSLYNTLMKSEPIALISVSKIATQRLPQVDPEFVEKHHDKLTEVWNVLGEDDEADDLKFA
NSLIFPTITDGWDELLKKNDIPPNSEVILSYYGYSIFAIDAFTVLDDVKTFPKYHSRCLD
PNSTFYFDVAVLNFNLNQSTMMLPKKFGDFLKQCRYHLLSCCTDLGTYHIFDVLLKNDKD
LTVQLGLDWNSFCQDNEFQPGIFRFKFSKDYSRSVCHVYQICTSATSSAN
Download sequence
Identical sequences A0A072VJX9
Medtr1g054495.1 XP_013467711.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]