SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g071540.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g071540.1
Domain Number 1 Region: 392-638
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000801
Family Tropomyosin 0.003
Further Details:      
 
Domain Number 2 Region: 218-415
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000024
Family Tropomyosin 0.00092
Further Details:      
 
Weak hits

Sequence:  Medtr1g071540.1
Domain Number - Region: 1158-1341
Classification Level Classification E-value
Superfamily Tropomyosin 0.0719
Family Tropomyosin 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr1g071540.1
Sequence length 1796
Comment | kinase interacting (KIP1-like) family protein | HC | chr1:31759548-31751721 | 20130731
Sequence
matatrshadsrrmyswwwdshispknskwlqenltdmdvkvkqmiklieedadsfarra
emyykkrpelmkmveefyrayralaerydhatgvirhahrtmaeafpnqipvmitddlpm
vtsmeteprtpetrhpsrtfldsdesekdahfikrngadseelhsalnktglrqlndlli
prehakfegharrglnfletqeesselnnggrgtkahvlseservtkaeaeisalkkala
kledekeagllqyqqsleklsnlelevssaqensqrvderaskaeaevqdlkeaviklqa
ereatllqyqeclekitdleknisfaqkdagefneratraetevdslkqdllrveaekev
allqykqcletlskleerlkeseenvrrinqqanlaeneiealklevtklneekedaalr
yqqcleiisslehklscaeeevgrlnskiddeveklhsseqkcllletsnhalqselqsl
ahkmgsqseelnekqkelgklwsslqeerlrfieaetafqtlqhlhsqsqedlralaadf
hgkleilgnvesrkqsledevhrvneenkilnelkissslsiqtlqdeilnlketiekle
qevelrlnernalqqeiyclkeelndmnkkheamidevrsadldpqcfgssvkqlqdens
klketceaekdeklallvkletmeklleknsvlensisdlnaeldsvrgkvnvlegtcqs
llvekstlaaekatlfsqlqattekleklsennnllenslfdvsteldvlrgkskileda
cqlldhekssissekealvselnttqqilkdlekqhselelmhlelkgeresslkkveel
lvslysqreehcrvlklnedevankelqidilkedakcrkqeyeeeldrslnaqieifil
qkciqdlekrnfsllvecqrlleaskmsdkiisnleteniqkqddvdslsdkikilrvgl
hqvlktldingdnffedmldedqtllnhihgklkerkksfdaifkeshhltvensvlitf
leqlkmtvenlviekgaldeeskiqskqftalqiefqkaleknqelklaiskgeekmegm
taeivnlreelsnfekihrnlheksctiieekksllgrfkdlseekgnleeelcvlshet
fvqsnisaiyeniiseklqelkqlgqeldklgsennnleerlkimahkleneemenshlk
elfvksnvelnlvesvndqltcqirneremlcqkekvlseaaktfhalhtektelqrtae
dlkiryddakgkleeqanrishlssdkdrqneelgclsevnqklesemkclhqeleeikl
rekklsyevhegineieqwetqaavlfaelqvsavnetllqgkaceladtcehlesinys
kdmereqlkelvsklegengkmcdqlaayvpaisalndcvtslevqtlghpkhhdyekpe
vknlvnhqyiengqqideyqsvtapdplldfqdlqrrineismavknfnasskanvemre
iqeakeieqkmgslrpdnpvteievlpkdimldqisecssygvsrggtlesddhmlelwe
tsdktpkmaaepaedhhqrrasketynkhpsgdslvekelgvdkleisrrmsrpreegnk
srvlerldsdsqkltnlqitiqdlmkkvetiekstkgksaeydtvkeqleasqetvmklf
danrklvknveegalssagrassesdeigsvsrrrfseqaqrgsekigqlqlevqrlqfl
llklndakeskektkmadqsrrvrlrdylyggtktnnqkkkktpfcacvrpptkgd
Download sequence
Identical sequences G7IDL0
XP_003590595.1.50012 Medtr1g071540.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]