SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g090753.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g090753.1
Domain Number 1 Region: 29-120
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000647
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr1g090753.1
Sequence length 169
Comment | hypothetical protein | LC | chr1:40770750-40771339 | 20130731
Sequence
MESCSSSICELPTNQRSVNNSIAPFMTSESNRPYFIAVCTEIICELDPLIIADLYDELQD
ELTLIDGYVNSHEVEFNKILLMPILTQGWHEFRNFYNFTSNPLMSYTYLGNSVFQTQIFN
GSTTTNEYPRYHRLTTSNLRDVTFEVDMPNNYPISSKLVNLLSFATLSN
Download sequence
Identical sequences A0A072VZ53
Medtr1g090753.1 XP_013469292.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]