SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr1g098450.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g098450.1
Domain Number 1 Region: 206-289
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000112
Family B3 DNA binding domain 0.0089
Further Details:      
 
Weak hits

Sequence:  Medtr1g098450.1
Domain Number - Region: 12-76
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00216
Family B3 DNA binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr1g098450.1
Sequence length 318
Comment | B3 DNA-binding domain protein | LC | chr1:44323895-44325486 | 20130731
Sequence
MIFQVSESDTKFCKIIDEDCLGNDDLMITALSSKFWDYISSPVCLQLPDKTTWLLDWKQH
DDTHVLFNKWKAFAEPHIYPINIFNLSIFDETDTEIEYPMLSSLFSPWETKTTKPAVSLY
HLNRMKKTNQQEEPKGYLSLLAEICGQSPSQMTMPVEYADFYTANPKKRGRRREVPYNTR
GSSTMKQRKVLGTGALERAKACCSHIKSFIRQMRPSHIQRNVLVIPRNFLTTRQQQESAM
FWIVEAKRFCDGWKNFVTDNKLKQGDVCVFQLVEAPRLFFEVVIFRAREQSTPPHIQGTF
DLLQSNLQFLMHTYILAP
Download sequence
Identical sequences G7IBX1
Medtr1g098450.1 XP_003592074.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]