SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g010420.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g010420.2
Domain Number 1 Region: 353-574
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000000915
Family Tropomyosin 0.0023
Further Details:      
 
Domain Number 2 Region: 136-376
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000196
Family Tropomyosin 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr2g010420.2
Sequence length 741
Comment | frigida-LIKE protein | LC | chr2:2359959-2364442 | 20130731
Sequence
MVVRSSKRKKLLNLYDSKSDDDDDVPLRAKSLSTLNLGASSSSSSSKCDDSVENRHTRLP
AKRPFDDNIPSQTSVKKSKLSSFSINLMKKSILGLRSVEEEKLQSLERDIEECSKELLNK
KKQASDVRQTNQYYEEMQNKIEKGVKDLAANEEHVRFIKGLIKKKTLELKKNKRQLLAAM
DSNNRGRGRLKEKELETLSQKIDECNEEIKTRKEELDALKISVSHKIKELMSERSNILNA
MSERRTGQLVQMKDLESTKKQFEGRATEFDSKMKQCDRRIEGVESNEKLYEGRTKVSESK
QEEFERQVKELESKKKQFESQEKVLGLKEKLFERQVDDLESFKEHFGSQLKGLKSKEKIF
ERRMKELKSKEEHFQRRVKVFGLRECDFEGQVKDFESKLKQYEGQVKELQSKKEEFEGRV
EEFKSQEKDFESRVKGFESKEKDFESRVRKFESVEKDFESLVKKFESVEKDFESRVRKFE
SVEKDFESRVKKFESVEKDFESRVRKFESVEKDFEIRVRKFESVEKDFESRVRKFESVEK
DFESRVRKFESKEEELELRDGQYETLIKSFEEEIESDDQPSPTIDGRSLQFLPIEEIDEL
ESHGNDSLANLLASSSDPSKDVLDIIQNPIIPQCKGENVVIIDDHHIDLLEQLMRISPHV
KPHVREEAMKLALKLKAYIGENTENPVPVLGFLLLLSIYGLVSSFDEDEILKLFGFAAQH
KISVELFGTMGLAHKVSGMLV
Download sequence
Identical sequences A0A072VE78
Medtr2g010420.2 Medtr2g010420.3 XP_013462430.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]