SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g018690.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g018690.1
Domain Number 1 Region: 112-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-49
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 774-850
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000334
Family PB1 domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr2g018690.1
Sequence length 908
Comment | auxin response factor 2 | HC | chr2:5912688-5906356 | 20130731
Sequence
MRLSSASFSPPPQEGEKRVLDSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTNKE
VDAHIPNYPSLPPQLICQLHNLTMHADVETDEVYAQMTLQPLNAQEQKEAYLPAELGTPS
KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHGNEWKFR
HIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPSSVL
SSDSMHLGLLAAAAHAAATNSRFTIFYNPRACPSEFVIPLAKYVKAVYHTRVSVGMRFRM
LFETEESSVRRYMGTITGICDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLT
TFPMYPSPFPLRLKRPWPPGLPSFHGMKDDDFGMSSPLMWLRDTDRGLQSLNYQGIGVNP
WMQPRFDPAMLNMQTDMYQAVAAAALQDMRTVVDPSKQLPGSLLQFQQPPNFPNRTAALM
QAQMLQQSQPQQAFQNNNQENQNLSQSQPQAQTNPQQHPQHQHSFNNQLHHHSQQQQQTQ
QQVVDNNQQISGSVSTMSQFVSATQPQSPPPMQALSSLCHQQSFSDSNVNSSTTIVSPLH
SIMGSSFPHDESSLLMSLPRTSSWVPVQNSTGWPSKRIAVDPLLSSGASQCILPQVEQLG
QARNSMSQNAITLPPFPGRECSIDQEGSNDPQSNLLFGVNIDPSSLLLHNGMSNFKGISG
NNNDSSTMSYHQSSSYMNTAGADSSLNHGVTPSIGESGFLHTQENGEQGNNPLNKTFVKV
YKSGSFGRSLDITKFSSYNELRSELARMFGLEGELEDPVRSGWQLVFVDRENDVLLLGDG
PWPEFVNSVWCIKILSPEEVQQMGNTGLGLLNSVPIQRLSNSICDDYVSRQDSRNLSSGI
TTVGSLDY
Download sequence
Identical sequences G7IP35
XP_003593869.1.50012 Medtr2g018690.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]