SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g028950.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g028950.2
Domain Number 1 Region: 264-375
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000171
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 60-190
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000942
Family BTB/POZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr2g028950.2
Sequence length 509
Comment | regulatory protein NPR1 | HC | chr2:10780227-10774940 | 20130731
Sequence
MANSAEPSSSLSNNTSSSHLSNGSISHNICPNGSDHARNLEVISLNKLSSNLEQLLIDSD
YDYGDADIIVEGIPVRIHRCILGSRSKFFHEIFKRSKDKGLSKNEGRLKYCLSDLLPYGK
VGYEAFLIFLSYVYSGKLKPSPMEVSTCVDNVCAHDACGPAINFAVELMYASSIFQIPEL
VSLFQRRLLNFVGKALVEDVISILMASFHCQLNQLAAQCVDRVARSDLDQISIEKELPHE
LSEKVKLLRRDLHQNDENDAPVVDTLSLKRITRIHKALDSDDVELVKLLLNESDITLDEA
GALHYAVAHCDPKVVSEVLGLGLANVNLRNSRGYTVLHIAAMRKEPSIIVSLLTKGACAS
DLTFDGQSAVSICRRLTRPKDYHTKTEQGKETNKDRICIDVLEREMRRNPLATDPSVSSH
TVADDLHMKLLYLENRVAFARLFFPLEAKLAMDIARAETTSEFAGLSASKGSNGNLREVD
LNETPIMQNKRLISRMEALMKTGQQVTSL
Download sequence
Identical sequences A0A072V6N6
XP_013462968.1.50012 Medtr2g028950.2 Medtr2g028950.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]