SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g039880.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g039880.1
Domain Number 1 Region: 259-370
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.27e-17
Family Ankyrin repeat 0.00067
Further Details:      
 
Domain Number 2 Region: 41-187
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000018
Family BTB/POZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr2g039880.1
Sequence length 584
Comment | regulatory protein NPR1 | HC | chr2:17472303-17469747 | 20130731
Sequence
mmylrsgfseysneisnntsselccttapnstitasqdvitftqplnrlsdnlasilddt
gfdffsdakiiakdgrevsvhrcilsarssffkdvfkgkkettlqlkevakdydvgfdal
nvvlrylyservedhhlsakdvcvcvdddclhfgcwpvvdfmlqllyasftfqisellal
yqdhlldildkmaiddmlvvlsianicgktcdkllkrctdiivesnvdittlekslpqsi
vklvtykrkqlgldmyetvnlldkhvtrihraldsddvelvrlllkeghttldeahalhy
avaycdvktttelldlgladvnhknlrgysvlhvaakrkepkiivslltkgaqpseltmd
grkalqiskrctkavdyyksteegkvssndrlcieileqaerreplhgeaslslakagdd
lrmkllylenrvglakllfpmeakvvmditpidgtseftpnlggyqrttmdlneapfkik
eehlirmkalsravelgkrffprcsevlnkimdaddlsqlacmghdspedrqvkrrryae
lqevlnkvfhedkeefdksgmsssssstsigmprannsmiamnh
Download sequence
Identical sequences G7IQ63
XP_003595225.2.50012 Medtr2g039880.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]