SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g042450.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g042450.1
Domain Number 1 Region: 9-356
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.54e-117
Family IF2B-like 0.0000000626
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr2g042450.1
Sequence length 372
Comment | methylthioribose-1-phosphate isomerase | HC | chr2:18531206-18527006 | 20130731
Sequence
massdsnatnmlqairynrgslqlldqtklplesvyleirdsndgwnairdmvvrgapai
aiaaalslavevsnlddfngstddavyflqkkldylvssrptavnlsdaatklkeiiska
aattseakgvfqayleaaeimleddvasnraigtygasfiqnqteklklsvlthcntgsl
atagygtalgviralysggvlerayctetrpfnqgsrltayelvhdkipatliadsaaaa
lmqagrvdavvvgadrvasngdtankigtysvalcakfhnvpffvaapltsidlslssgq
qivieerspkellnmrgglgeqvaasgisvwnpafdvtpanlisgiitekgvitktpagd
afdikafvqktg
Download sequence
Identical sequences G7IGG7
XP_003595318.2.50012 Medtr2g042450.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]