SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g043250.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g043250.1
Domain Number 1 Region: 116-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.26e-43
Family B3 DNA binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 999-1064
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000157
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr2g043250.1
Sequence length 1114
Comment | auxin response factor 2 | HC | chr2:18843526-18835022 | 20130731
Sequence
MKAPSNGYLANSGEGERKAINSELWHACAGPLVSIPPVGSLVVYFPQGHSEQVAASMQKE
ADIIPSYPNLPSKLICMLHNVALHADPETDEVYAQMTLQPVNKYDKEAMLASDMGLKQNQ
QPSEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQEIVAKDLHDTTWTFRH
IYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDEKQQLLLGIKRSSRQQPALSSSVIS
SDSMHIGILAAAAHAASNNSPFTIFYNPRTSPCEFVIPLAKYNKALYTHVSLGMRFRMMF
ETEDSGVRRYMGTITGISDLDPVRWKNSQWRNLQVGWDESTAGERPSRVSIWDIEPVVTP
FYICPPPFFRPKFPKQPGMPEDESEIENAFKRAMPWLGDELGMKDTSSSVFPGLSLVQWM
SMQQNNNQFSAAQSGLLPPSMLSSNAMHGNLNTDDPSKILNFQSPAALSAPSLQFNKPNL
PNQVNQLQQPPASWSQQQQQQQKMQSLLPMPLNQLQQQQQRQQQLAGSQNLPQPQQQQPQ
LTQQSPQQPQQQQQHQQPCQNTTMNNGTIGSNQIPNQCVQQPVTYSQLQQQLLSGSMQSQ
QNLQSAGKNGLMMTSLPQDSQFQQQIDQQQAGLLQRQQQQNQLQQSSLQLLQQSMLQRGP
QQPQMSQTVPQNISDQQQQLQLLQKLQQQQQQQQQQQPLSTSSQLLQSQLLPQQSQQMPQ
QPMSQHQPQQLGNNAFSMEKLLNNNYSSSPLMHPQQLPVNHLQNTQKSPTNTRAPSAFTD
GDAPSCSTSPSTNNCQTSPPNPLKRNQPDTFGGPSMVETTNNLMQELQSKSDMQSKHELH
GVKGPDKQKHKGAINDHMEASSGTSYGIDPGNIHQNFPLSNFYMDGDVHSQQPRSNIPFA
SNLDGLTPDPLLSRGYDSQKDLQNLLSNYGGAPRDIETELSTADISSQSFGVPNMSFKPG
CSNEIPIADTGVLNNGLWSNQNQRMRTYTKVQKCGSVGRCIDVTRYKGYEELRNDLARMF
GIEGQLEDPVRVDWKLVYVDHENDILLVGDDPWEEFVNCVQSIKILSSAEVQQMSLEGDL
GYNIPITNQACSGSESGNAWRAQYDDNSAASFNR
Download sequence
Identical sequences A0A072V7K3
XP_013463581.1.50012 Medtr2g043250.1 Medtr2g043250.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]