SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g058520.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g058520.1
Domain Number 1 Region: 63-172
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000569
Family B3 DNA binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr2g058520.1
Sequence length 181
Comment | E1 protein | HC | chr2:24182817-24183362 | 20130731
Sequence
MNNIHLRVEMEQLQKKRKSCDEASTNLKTSRRRLCNNKNEEQNNNQNNDNKGSVSTTLKL
YDDPWKIKKSLTESDLGILSRLLLAADLVKKQILPMLDVDDARAAETEEGSPVNVWDMET
NSMHELVLKRWSSSKSYVLIGKWNQDFVRRRELKKGDEIGFQWDPFNRAFNFCVLKRAIP
P
Download sequence
Identical sequences G7IQL4
XP_003595647.1.50012 Medtr2g058520.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]