SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g091015.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g091015.1
Domain Number 1 Region: 415-638
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000172
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 2 Region: 224-473
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000275
Family Tropomyosin 0.0032
Further Details:      
 
Weak hits

Sequence:  Medtr2g091015.1
Domain Number - Region: 110-281
Classification Level Classification E-value
Superfamily Tropomyosin 0.00883
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr2g091015.1
Sequence length 895
Comment | frigida-LIKE protein | LC | chr2:39135884-39140095 | 20130731
Sequence
MDIVEATHKPKFCVGDEEYLNFKWLASFDKNTSQSASREDDDDDALSARFHKKRDTTTLS
VKRVFDDNNSLCGSMKKSKVSPTPYDDDDDDDDDDDDDDDDDDDMSTDKSFSTLKEKLVL
VEKSFEDIRSKTQVEERRLQSIKRDIEECCEDLENKKKEIRDVGRIIEARKKMQGKIDEC
VKDFVAKEGQLGLMEDLIGEHKKELKTKELELRQVMDNISKQKELESQVKELVNDLVSKQ
KHFESHIKELESKERQLEGRLKEHELEEKEFEGRMNELESKERHFKSEVEEINAKLMPLK
GQIKELASKEKQLNGQVKELESKKNQFENRIKELESKEKQHEGRVKEHASKEREFESQVM
EQQFKKKLFEIQVKALESKENQLVDQMKEFKSKEMEFEGQMKEMVLNQNHFDSRMMDLES
KVKEHELKEKEFEGRMKEFESKKKGFAGRLKDLVNNLVSKQKHLENQAKELHSKEKQHEG
RVMEHESKVREFEVKMMDLESKMKQFESQVEELKSKERHSQGQFKELESKEKKLDGRLKE
LKLKEDEFEGRVKELESEKKHFESRQKQLETQEKQYEEQMKEFQSKEEEFKVHVKDFESK
DEEFEDQVKELKSKKKQFENQVEDFKSKEKQLESQVEDYKSKEKQIEERWKELESKENKF
KVLVKELKLKEGQIKDPGSKLDKFDGQLKEPELTEKQFESLINYFDEEKESVASNTDDQL
SPTIDGTSLQLLPSDETVILVNLQESSDPAKVVLDIIQKPIIPRCKNGEHAVIIDDGCIF
LLEQLMRISPKIKPDVREEALKLALNLKANMKNTENSLVVLGFLLILSVYELLTYFDEDE
VLELFTFVAQHKTAVELFKTLGFANKLSEFVEDLIRKKQFVVLTAWLRRIKKFLC
Download sequence
Identical sequences G7ZVK0
Medtr2g091015.1 XP_013465204.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]