SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g091280.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g091280.1
Domain Number 1 Region: 400-643
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000817
Family Tropomyosin 0.00054
Further Details:      
 
Domain Number 2 Region: 293-403
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000654
Family Tropomyosin 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr2g091280.1
Sequence length 730
Comment | myosin heavy chain-like protein, putative | LC | chr2:39416847-39414655 | 20130731
Sequence
MDVVEASDKPIFCVGDDEEHFNFKWLASFDKKTSHSASREDFESDDDDDDVPLSARFAKK
RGATTLPIKRAFDNNNSLCCLMKKSKVSPKPYDDNDVKDNDDYVPAMSTDKSISELKKEL
AFIEKSFEERRRDMQVEKKRLHSIKRDIEECCRELENKQKEISYVGRINEEAHKKMQVKT
EECVKDFVAKEGQLYLVEELIRERKQELKTKELELRQITDNISKQKEFESQVKELGNDLV
SEHMHYKSRMKELESNEKQLGGQLKEHESEEKEFEDRVNELESKERYFNNWVEELNTKLM
PLKGQFKELASKEKQLDGQVKELESKKKQFENRIKELESKEKQHEGRVNEHASKEREFEG
QVKELKSKKKLFEIQVKELESKEQQLVDQMKEFKSKEREFEGQMKELASKQKHFKRRMKE
LEAKEKQHEGQVKECESKEREFKSQVRELESKKKQFERQVKELESKYNRVGQVKEFEPKE
REIEGEAKELVLMVLKQKHLESQVKELESKAKQDEVRLKEHELNERELKGQVNDLVSKLN
HFESRMKELESKEKQHEGRVKELESEKKHFESQLKELESKENQFKERMKEFQSKEEELKG
QVKEFESKEKKFREQMKEFHSKEGEFKGQVKEFESKEEEFKGQVKELKSKEKQFEERWKE
LKTNENKFKLLVKELKLNEKQFEGQVKDPESKLEKFDGHRKESELREKQYEPLIKDFDEG
SKSGKCSYLV
Download sequence
Identical sequences A0A072VMC1
Medtr2g091280.1 XP_013465250.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]