SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g093010.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g093010.1
Domain Number 1 Region: 418-608
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000137
Family Tropomyosin 0.0019
Further Details:      
 
Domain Number 2 Region: 219-430
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000916
Family Tropomyosin 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr2g093010.1
Sequence length 859
Comment | frigida-LIKE protein | LC | chr2:39601609-39605243 | 20130731
Sequence
MNFEASDKPKFCGNGDDEGREAVSCEHFESEDDDVPLLPRFTRISSLVKYDVSVKKRDFE
FHDNNSLPISVKKSKVSLYHDHDNDEDDIPLLDLIKRPSKSTDKSFSSLKKGLALLENSF
QEGNKKTKLEENRLQSIKIDIQECRKELENKKKEISCFRGIFEAHEKMQGKIEECIKDFV
VKEGQLYFMDDLIGERKLELKTKEMELNQVKGNISKEIELRRVIDNIDKDRERKEEELKA
LSQKIAEFTLELKAKEIELDAMNRLIGGQAEKLESKRKKLLKLTSEKENGRAQIKEFESI
KKQLEGQVKELESKEKQCDEQVEALMSREKQLEGHMKEFESKMQELEGRTTQLESKEKQV
EGRAMELKLKEMQFEGREKEFKLKEEKFEGLTKEMLFKKEHFENQLNVLESIDNQLVCQV
KEFESKQKEFEFQKKELILKQKHFESRIKKLESEEKKHESRLKEHESKEREFEGQVTELE
SKKKHFESHVEELTSNLWQLKGQVKELESKEKQFDSRVKAFESKEDEFEGRAKEHESKER
EFEIQAKELESKKKHFESQVEEFTSKLWQLKGQVKELEYKEKQFDSRVKAFESKEVEFKD
RVREFEVKQLEVQLKELKSKENQFEGEVKDVESMQNEFDGELKKLELREDQYEALLKSFD
EEIKSDDQSTPTIDGRSLQLLPSDETEILDNLQGSSDPSKVVLDIIQNPIIQKYKMGDNA
VIIDDRDILLLKQLMRIKPHIKPRVREEAMKLALNLKSNISENTENLVAVLGFLLLVSIY
GLAPSFDEDEVLKLFEFAAQDKIAVELFGTLGFADKASDFVQKLIMKKQNIEAARFIRAY
IMPTRIKQTISCNQENRLH
Download sequence
Identical sequences G7IU33
Medtr2g093010.1 XP_003597132.2.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]