SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr2g093740.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g093740.1
Domain Number 1 Region: 164-278
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-43
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 685-761
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000145
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr2g093740.1
Sequence length 810
Comment | auxin response factor-like protein | HC | chr2:39984806-39979874 | 20130731
Sequence
MEIDLNDSITEVKKNVCSNGKCEKSVCCVCTLSSSSSPTCSSSSSTSAIVSSSYLELWHA
CAGPLTSLPKKGNVVVYFPQGHLEQVASLSLFSSLEIPTYGLQPQILCRVVNVQLLANKE
NDEVYTQVALLPQAELAGMCLDDKEPEGLEADDEGNGRSPTKLASHMFCKTLTASDTSTH
GGFSVPRRAAEDCFPPLDYKQQRPSQELVAKDLHGVGWKFRHIYRGQPRRHLLTTGWSIF
VSQKNLVSGDAVLFLRGENGELRLGIRRAARPRNGLPESIIGNQSCSPSFLSSVANAISA
KSMFHVFYSPRASHADFVVPYQKYAKSIRNPVTIGTRFKMKFEMDESPERRCSSGIVTGM
SDLDPYKWPKSKWRCLMVRWDEDIGANHQDRVSPWEIDPSTSLPPLNIQSSRRLKKLRTG
LHVESPSHFITAGDSGFMDFDESIRSSKVLQGQEKTSFMSLYYGCDTVTKQKEFDINSLR
HTNLASNGARKITSSEFTRIQPSSYADFTEMNRFPRVLQAQEIYPLRSLTGKVDLNLNSW
GKTNVSYTKYNLHNATKLNFHSLGSEVLQNSSFPYGDIHKVGQGSSMLCSKPTNFQLGNV
SFNTPSSQIGALRNEVGLSSFKIRNEQKLQNDISAATSLDANIRISNDENFKEMVNPCKL
FGFSLSAAAETTSQNLQNSAKRSCTKVHKQGSLVGRAIDLSRLSSYNDLVSELERLFGME
GLLRDPDKGWRILYTDSENDIMVVGDDPWHEFCDMVSKIHIYTQEEVEKMTIGMMNDDNQ
SCLEQTPLIMEASKSSSVGQPDSSTTVVRI
Download sequence
Identical sequences Q2HSV9
XP_003597191.2.50012 Medtr2g093740.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]