SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr3g005440.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g005440.1
Domain Number 1 Region: 32-111
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-16
Family B3 DNA binding domain 0.0018
Further Details:      
 
Domain Number 2 Region: 240-333
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.81e-16
Family B3 DNA binding domain 0.0017
Further Details:      
 
Weak hits

Sequence:  Medtr3g005440.1
Domain Number - Region: 148-212
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00128
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr3g005440.1
Sequence length 442
Comment | B3 DNA-binding domain protein | LC | chr3:203074-205412 | 20130731
Sequence
MLPKFEPTWVGLVVLTWDQGVCFSLRFEVRLSLVQIPDEFITRFGNELDNVATITVPDGR
EWDMELKKCGGQVFFCNNWQHFAEYYSISYGCYLDFKYEGNSNFVVVIYDPTFVEISYPF
KTSSTNGDQSIKGPNSDSKRANCAVGEFNPKNPYFHSKSIKGIFAYVPSGFAKKYLMLMV
PFIGFSKFARENNLLEGVTYVFELIKRKPVVVVLQVTASCTPPQGRSSQSLTEKEVRESE
HFKMDILPSPIHDKEIRISDEFITRFGIELKNVATVTATDGRDWRMRLKKHGNDIFFYNE
WQEFAKYYSLGCGCYLSFKYEGNSKFSVVIFDVTSVEICYPLKTPSTNGETNTQCPTPRK
SSRVETIGSQVIKLKIRFGHAFKSAEVAANEFNPKNPYFWLKNVTAKFAQKYLMPNVPIA
LQNSQGKHWKVHCILYNPKSFS
Download sequence
Identical sequences G7IYE6
Medtr3g005440.1 XP_003598027.2.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]