SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr3g013920.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g013920.1
Domain Number 1 Region: 85-191
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000922
Family B3 DNA binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr3g013920.1
Sequence length 198
Comment | B3 domain plant protein | LC | chr3:3826076-3826672 | 20130731
Sequence
mnesvenctmkqrssfdykmkrkvddeisftpgerevarillsmqkiedekrrtynnnah
papqiniptipgvtnndilfcckpfvkklyptdlepgqsrlllnknhvktyflpllkkge
edvregidvvvydmqgntfnmifkfwsekvyvlsggrwvnfyrthqlkaiedhvtvwmfr
hsqtnqlcfalsvrkvqt
Download sequence
Identical sequences G7IYP4
Medtr3g013920.1 XP_003598455.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]